Lineage for d1gt0d_ (1gt0 D:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1725579Fold a.21: HMG-box [47094] (1 superfamily)
    3 helices; irregular array
  4. 1725580Superfamily a.21.1: HMG-box [47095] (2 families) (S)
  5. 1725581Family a.21.1.1: HMG-box [47096] (10 proteins)
  6. 1725622Protein Sox-2 [81718] (2 species)
  7. 1725626Species Mouse (Mus musculus) [TaxId:10090] [81719] (1 PDB entry)
  8. 1725627Domain d1gt0d_: 1gt0 D: [76337]
    Other proteins in same PDB: d1gt0c1, d1gt0c2
    protein/DNA complex

Details for d1gt0d_

PDB Entry: 1gt0 (more details), 2.6 Å

PDB Description: crystal structure of a pou/hmg/dna ternary complex
PDB Compounds: (D:) transcription factor sox-2

SCOPe Domain Sequences for d1gt0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gt0d_ a.21.1.1 (D:) Sox-2 {Mouse (Mus musculus) [TaxId: 10090]}
drvkrpmnafmvwsrgqrrkmaqenpkmhnseiskrlgaewkllsetekrpfideakrlr
alhmkehpdykyrprrktkt

SCOPe Domain Coordinates for d1gt0d_:

Click to download the PDB-style file with coordinates for d1gt0d_.
(The format of our PDB-style files is described here.)

Timeline for d1gt0d_: