Lineage for d1gt0d_ (1gt0 D:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 535057Fold a.21: HMG-box [47094] (1 superfamily)
    3 helices; irregular array
  4. 535058Superfamily a.21.1: HMG-box [47095] (1 family) (S)
  5. 535059Family a.21.1.1: HMG-box [47096] (9 proteins)
  6. 535099Protein Sox-2 [81718] (2 species)
  7. 535102Species Mouse (Mus musculus) [TaxId:10090] [81719] (1 PDB entry)
  8. 535103Domain d1gt0d_: 1gt0 D: [76337]
    Other proteins in same PDB: d1gt0c1, d1gt0c2
    mutant

Details for d1gt0d_

PDB Entry: 1gt0 (more details), 2.6 Å

PDB Description: crystal structure of a pou/hmg/dna ternary complex

SCOP Domain Sequences for d1gt0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gt0d_ a.21.1.1 (D:) Sox-2 {Mouse (Mus musculus)}
drvkrpmnafmvwsrgqrrkmaqenpkmhnseiskrlgaewkllsetekrpfideakrlr
alhmkehpdykyrprrktkt

SCOP Domain Coordinates for d1gt0d_:

Click to download the PDB-style file with coordinates for d1gt0d_.
(The format of our PDB-style files is described here.)

Timeline for d1gt0d_: