SCOPe 2.07: Domain d1gt0c2: 1gt0 C:3-77

Lineage for d1gt0c2 (1gt0 C:3-77)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.1: POU-specific domain [47414] (3 proteins)

6. Protein Oct-1 [47415] (1 species)
   canonical 4-helical fold

7. Species Human (Homo sapiens) [TaxId:9606] [47416] (7 PDB entries)

8. Domain d1gt0c2: 1gt0 C:3-77 [76336]
   Other proteins in same PDB: d1gt0c1, d1gt0d_
   protein/DNA complex

Details for d1gt0c2

PDB Entry: 1gt0, 2.6 Å

PDB Description: crystal structure of a pou/hmg/dna ternary complex

PDB Compounds: (C:) octamer-binding transcription factor 1

SCOPe Domain Sequences for d1gt0c2:

Sequence; same for both SEQRES and ATOM records:

>d1gt0c2 a.35.1.1 (C:3-77) Oct-1 {Human (Homo sapiens) [TaxId: 9606]}
psdleeleqfaktfkqrriklgftqgdvglamgklygndfsqttisrfealnlsfknmsk
lkpllekwlndaenl

Timeline for d1gt0c2:

• d1gt0c2 first appeared in SCOP 1.63
  
• d1gt0c2 appears in SCOPe 2.06
  
• d1gt0c2 appears in the current release, SCOPe 2.08