Lineage for d1gt0c2 (1gt0 C:3-77)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 354938Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 354939Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (5 families) (S)
  5. 354940Family a.35.1.1: POU-specific domain [47414] (3 proteins)
  6. 354945Protein Oct-1 [47415] (1 species)
    canonical 4-helical fold
  7. 354946Species Human (Homo sapiens) [TaxId:9606] [47416] (7 PDB entries)
  8. 354948Domain d1gt0c2: 1gt0 C:3-77 [76336]
    Other proteins in same PDB: d1gt0c1, d1gt0d_
    mutant

Details for d1gt0c2

PDB Entry: 1gt0 (more details), 2.6 Å

PDB Description: crystal structure of a pou/hmg/dna ternary complex

SCOP Domain Sequences for d1gt0c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gt0c2 a.35.1.1 (C:3-77) Oct-1 {Human (Homo sapiens)}
psdleeleqfaktfkqrriklgftqgdvglamgklygndfsqttisrfealnlsfknmsk
lkpllekwlndaenl

SCOP Domain Coordinates for d1gt0c2:

Click to download the PDB-style file with coordinates for d1gt0c2.
(The format of our PDB-style files is described here.)

Timeline for d1gt0c2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gt0c1
View in 3D
Domains from other chains:
(mouse over for more information)
d1gt0d_