SCOP 1.71: Domain d1gt0c1: 1gt0 C:97-159

Lineage for d1gt0c1 (1gt0 C:97-159)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (13 families)
   consists only of helices

5. Family a.4.1.1: Homeodomain [46690] (28 proteins)
   Pfam 00046

6. Protein Oct-1 POU Homeodomain [46699] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46700] (7 PDB entries)

8. Domain d1gt0c1: 1gt0 C:97-159 [76335]
   Other proteins in same PDB: d1gt0c2, d1gt0d_
   mutant

Details for d1gt0c1

PDB Entry: 1gt0, 2.6 Å

PDB Description: crystal structure of a pou/hmg/dna ternary complex

SCOP Domain Sequences for d1gt0c1:

Sequence; same for both SEQRES and ATOM records:

>d1gt0c1 a.4.1.1 (C:97-159) Oct-1 POU Homeodomain {Human (Homo sapiens)}
glsrrrkkrtsietnirvaleksflenqkptseeitmiadqlnmekevirvwfsnrrqke
kri

Timeline for d1gt0c1:

• d1gt0c1 first appeared in SCOP 1.63
  
• d1gt0c1 appears in SCOP 1.69
  
• d1gt0c1 appears in SCOP 1.73
  
• d1gt0c1 appears in the current release, SCOPe 2.08