Lineage for d1gt0c1 (1gt0 C:97-159)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 210246Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 210247Superfamily a.4.1: Homeodomain-like [46689] (11 families) (S)
    consists only of helices
  5. 210248Family a.4.1.1: Homeodomain [46690] (21 proteins)
  6. 210318Protein Oct-1 POU Homeodomain [46699] (1 species)
  7. 210319Species Human (Homo sapiens) [TaxId:9606] [46700] (6 PDB entries)
  8. 210321Domain d1gt0c1: 1gt0 C:97-159 [76335]
    Other proteins in same PDB: d1gt0c2, d1gt0d_
    mutant

Details for d1gt0c1

PDB Entry: 1gt0 (more details), 2.6 Å

PDB Description: crystal structure of a pou/hmg/dna ternary complex

SCOP Domain Sequences for d1gt0c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gt0c1 a.4.1.1 (C:97-159) Oct-1 POU Homeodomain {Human (Homo sapiens)}
glsrrrkkrtsietnirvaleksflenqkptseeitmiadqlnmekevirvwfsnrrqke
kri

SCOP Domain Coordinates for d1gt0c1:

Click to download the PDB-style file with coordinates for d1gt0c1.
(The format of our PDB-style files is described here.)

Timeline for d1gt0c1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gt0c2
View in 3D
Domains from other chains:
(mouse over for more information)
d1gt0d_