Lineage for d1gt0c1 (1gt0 C:97-159)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2691779Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 2691904Protein Oct-1 POU Homeodomain [46699] (1 species)
  7. 2691905Species Human (Homo sapiens) [TaxId:9606] [46700] (7 PDB entries)
  8. 2691908Domain d1gt0c1: 1gt0 C:97-159 [76335]
    Other proteins in same PDB: d1gt0c2, d1gt0d_
    protein/DNA complex

Details for d1gt0c1

PDB Entry: 1gt0 (more details), 2.6 Å

PDB Description: crystal structure of a pou/hmg/dna ternary complex
PDB Compounds: (C:) octamer-binding transcription factor 1

SCOPe Domain Sequences for d1gt0c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gt0c1 a.4.1.1 (C:97-159) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]}
glsrrrkkrtsietnirvaleksflenqkptseeitmiadqlnmekevirvwfsnrrqke
kri

SCOPe Domain Coordinates for d1gt0c1:

Click to download the PDB-style file with coordinates for d1gt0c1.
(The format of our PDB-style files is described here.)

Timeline for d1gt0c1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gt0c2
View in 3D
Domains from other chains:
(mouse over for more information)
d1gt0d_