Class a: All alpha proteins [46456] (171 folds) |
Fold a.102: alpha/alpha toroid [48207] (5 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array |
Superfamily a.102.4: Terpenoid cylases/Protein prenyltransferases [48239] (4 families) |
Family a.102.4.2: Terpene syntases [48243] (1 protein) consists of two toroid domains: one of six and one of five hairpins |
Protein Squalene-hopene cyclase [48244] (1 species) |
Species Alicyclobacillus acidocaldarius [TaxId:405212] [48245] (4 PDB entries) |
Domain d1gszc1: 1gsz C:10-36,C:308-628 [76333] |
PDB Entry: 1gsz (more details), 2.8 Å
SCOP Domain Sequences for d1gszc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gszc1 a.102.4.2 (C:10-36,C:308-628) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius} ayartldraveyllscqkdegywwgplXispvwdtglavlalraaglpadhdrlvkagew lldrqitvpgdwavkrpnlkpggfafqfdnvyypdvddtavvvwalntlrlpderrrrda mtkgfrwivgmqssnggwgaydvdntsdlpnhipfcdfgevtdppsedvtahvlecfgsf gyddawkvirraveylkreqkpdgswfgrwgvnylygtgavvsalkavgidtrepyiqka ldwveqhqnpdggwgedcrsyedpayagkgastpsqtawalmaliaggraeseaarrgvq ylvetqrpdggwdepyytgtgfpgdfylgytmyrhvfptlalgrykqai
Timeline for d1gszc1:
View in 3D Domains from other chains: (mouse over for more information) d1gsza1, d1gsza2, d1gszb1, d1gszb2 |