Lineage for d1gs0a1 (1gs0 A:207-340)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 355838Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
    core: 4 helices: bundle; unusual topology
  4. 355839Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (1 family) (S)
    duplication: consists of 2 helix-loop-helix structural repeats
  5. 355840Family a.41.1.1: Domain of poly(ADP-ribose) polymerase [47588] (1 protein)
  6. 355841Protein Domain of poly(ADP-ribose) polymerase [47589] (3 species)
  7. 355853Species Mouse (Mus musculus) [TaxId:10090] [81765] (1 PDB entry)
  8. 355854Domain d1gs0a1: 1gs0 A:207-340 [76323]
    Other proteins in same PDB: d1gs0a2, d1gs0b2

Details for d1gs0a1

PDB Entry: 1gs0 (more details), 2.8 Å

PDB Description: crystal structure of the catalytic fragment of murine poly (adp-ribose) polymerase-2

SCOP Domain Sequences for d1gs0a1:

Sequence, based on SEQRES records: (download)

>d1gs0a1 a.41.1.1 (A:207-340) Domain of poly(ADP-ribose) polymerase {Mouse (Mus musculus)}
esqldlrvqellklicnvqtmeemmiemkydtkraplgkltvaqikagyqslkkiedcir
agqhgralveacnefytriphdfglsippvirtekelsdkvkllealgdieialklvkse
rqglehpldqhyrn

Sequence, based on observed residues (ATOM records): (download)

>d1gs0a1 a.41.1.1 (A:207-340) Domain of poly(ADP-ribose) polymerase {Mouse (Mus musculus)}
esqldlrvqellklicnvqtmeemmiemkydtkraplgkltvaqikagyqslkkiedcir
agqhgralveacnefytriphdfglsippvirtekelsdkvkllealgdieialklvkeh
pldqhyrn

SCOP Domain Coordinates for d1gs0a1:

Click to download the PDB-style file with coordinates for d1gs0a1.
(The format of our PDB-style files is described here.)

Timeline for d1gs0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gs0a2