Lineage for d1gqoo_ (1gqo O:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2116843Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) (S)
  5. 2116844Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 proteins)
    automatically mapped to Pfam PF01220
  6. 2116845Protein Type II 3-dehydroquinate dehydratase [52306] (6 species)
  7. 2116859Species Bacillus subtilis [TaxId:1423] [82349] (1 PDB entry)
  8. 2116874Domain d1gqoo_: 1gqo O: [76309]
    complexed with gol

Details for d1gqoo_

PDB Entry: 1gqo (more details), 2.1 Å

PDB Description: type ii dehydroquinase from bacillus subtilis
PDB Compounds: (O:) dehydroquinase

SCOPe Domain Sequences for d1gqoo_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gqoo_ c.23.13.1 (O:) Type II 3-dehydroquinate dehydratase {Bacillus subtilis [TaxId: 1423]}
phflilngpnvnrlgsrepevfgrqtltdietdlfqfaealhiqltffqsnhegdlidai
heaeeqysgivlnpgalshysyairdavssislpvvevhlsnlyareefrhqsviapvak
gqivglgaegyklavryllsqq

SCOPe Domain Coordinates for d1gqoo_:

Click to download the PDB-style file with coordinates for d1gqoo_.
(The format of our PDB-style files is described here.)

Timeline for d1gqoo_: