Lineage for d1gqof_ (1gqo F:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1839588Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) (S)
  5. 1839589Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 proteins)
    automatically mapped to Pfam PF01220
  6. 1839590Protein Type II 3-dehydroquinate dehydratase [52306] (6 species)
  7. 1839604Species Bacillus subtilis [TaxId:1423] [82349] (1 PDB entry)
  8. 1839610Domain d1gqof_: 1gqo F: [76300]
    complexed with gol

Details for d1gqof_

PDB Entry: 1gqo (more details), 2.1 Å

PDB Description: type ii dehydroquinase from bacillus subtilis
PDB Compounds: (F:) dehydroquinase

SCOPe Domain Sequences for d1gqof_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gqof_ c.23.13.1 (F:) Type II 3-dehydroquinate dehydratase {Bacillus subtilis [TaxId: 1423]}
phflilngpnvnrlgsrepevfgrqtltdietdlfqfaealhiqltffqsnhegdlidai
heaeeqysgivlnpgalshysyairdavssislpvvevhlsnlyareefrhqsviapvak
gqivglgaegyklavryllsqq

SCOPe Domain Coordinates for d1gqof_:

Click to download the PDB-style file with coordinates for d1gqof_.
(The format of our PDB-style files is described here.)

Timeline for d1gqof_: