Lineage for d1gqlb1 (1gql B:152-704)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2416558Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2418664Family c.1.8.10: alpha-D-glucuronidase/Hyaluronidase catalytic domain [82253] (4 protein domains)
    Glycosyl hydrolase family 67, GH67; structurally related to GH20; contains extra C-terminal alpha-helical subdomain
  6. 2418665Protein alpha-D-glucuronidase catalytic domain [82254] (2 species)
    inverting reaction mechanism
  7. 2418674Species Pseudomonas cellulosa [TaxId:155077] [82255] (5 PDB entries)
  8. 2418682Domain d1gqlb1: 1gql B:152-704 [76293]
    Other proteins in same PDB: d1gqla2, d1gqlb2
    complexed with bdp, co, edo, xyp

Details for d1gqlb1

PDB Entry: 1gql (more details), 1.67 Å

PDB Description: structure of pseudomonas cellulosa alpha-d-glucuronidase complexed with glucuronic acid and xylotriose
PDB Compounds: (B:) alpha-d-glucuronidase

SCOPe Domain Sequences for d1gqlb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gqlb1 c.1.8.10 (B:152-704) alpha-D-glucuronidase catalytic domain {Pseudomonas cellulosa [TaxId: 155077]}
lqhrvvnhwdnlnrvvergyaglslwdwgslpnylaprytdyarinaslgingtvinnvn
adprvlsdqflqkiaaladafrpygikmylsinfnsprafgdvdtadpldprvqqwwktr
aqkiysyipdfggflvkadsegqpgpqgygrdhaeganmlaaalkpfggvvfwrafvyhp
diedrfrgaydefmpldgkfadnvilqikngpidfqprepfsalfagmsrtnmmmefqit
qeyfgfathlayqgplfeeslktethargegstignilegkvfktrhtgmagvinpgtdr
nwtghpfvqsswyafgrmawdhqisaataadewlrmtfsnqpafiepvkqmmlvsreagv
nyrsplglthlysqgdhygpapwtddlpradwtavyyhrasktgigfnrtktgsnalaqy
pepiakawgdlnsvpedlilwfhhlswdhrmqsgrnlwqelvhkyyqgveqvramqrtwd
qqeayvdaarfaqvkallqvqereavrwrnscvlyfqsvagrpipanyeqpehdleyykm
larttyvpepwhp

SCOPe Domain Coordinates for d1gqlb1:

Click to download the PDB-style file with coordinates for d1gqlb1.
(The format of our PDB-style files is described here.)

Timeline for d1gqlb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gqlb2