Lineage for d1gqla2 (1gql A:5-151)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 507855Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 508285Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (2 families) (S)
    contains similar fold but lacks its catalytic centre
  5. 508315Family d.92.2.2: alpha-D-glucuronidase, N-terminal domain [82737] (1 protein)
    family GH67
  6. 508316Protein alpha-D-glucuronidase, N-terminal domain [82738] (2 species)
    inverting reaction mechanism
  7. 508325Species Pseudomonas cellulosa [TaxId:155077] [82739] (5 PDB entries)
  8. 508330Domain d1gqla2: 1gql A:5-151 [76292]
    Other proteins in same PDB: d1gqla1, d1gqlb1

Details for d1gqla2

PDB Entry: 1gql (more details), 1.67 Å

PDB Description: structure of pseudomonas cellulosa alpha-d-glucuronidase complexed with glucuronic acid and xylotriose

SCOP Domain Sequences for d1gqla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gqla2 d.92.2.2 (A:5-151) alpha-D-glucuronidase, N-terminal domain {Pseudomonas cellulosa}
edgydmwlryqpiadqtllktyqkqirhlhvagdsptinaaaaelqrglsgllnkpivar
deklkdyslvigtpdnspliaslnlgerlqalgaegylleqtrinkrhvvivaansdvgv
lygsfhllrliqtqhaleklslssapr

SCOP Domain Coordinates for d1gqla2:

Click to download the PDB-style file with coordinates for d1gqla2.
(The format of our PDB-style files is described here.)

Timeline for d1gqla2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gqla1