SCOPe 2.06: Domain d1gqkb2: 1gqk B:5-151

Lineage for d1gqkb2 (1gqk B:5-151)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families)
   contains similar fold but lacks its catalytic centre

5. Family d.92.2.2: alpha-D-glucuronidase, N-terminal domain [82737] (1 protein)
   family GH67
   automatically mapped to Pfam PF03648

6. Protein alpha-D-glucuronidase, N-terminal domain [82738] (2 species)
   inverting reaction mechanism

7. Species Pseudomonas cellulosa [TaxId:155077] [82739] (5 PDB entries)

8. Domain d1gqkb2: 1gqk B:5-151 [76290]
   Other proteins in same PDB: d1gqka1, d1gqkb1
   complexed with bdp, co, edo

Details for d1gqkb2

PDB Entry: 1gqk, 1.9 Å

PDB Description: structure of pseudomonas cellulosa alpha-d-glucuronidase complexed with glucuronic acid

PDB Compounds: (B:) alpha-d-glucuronidase

SCOPe Domain Sequences for d1gqkb2:

Sequence; same for both SEQRES and ATOM records:

>d1gqkb2 d.92.2.2 (B:5-151) alpha-D-glucuronidase, N-terminal domain {Pseudomonas cellulosa [TaxId: 155077]}
edgydmwlryqpiadqtllktyqkqirhlhvagdsptinaaaaelqrglsgllnkpivar
deklkdyslvigtpdnspliaslnlgerlqalgaegylleqtrinkrhvvivaansdvgv
lygsfhllrliqtqhaleklslssapr

Timeline for d1gqkb2:

• d1gqkb2 first appeared in SCOP 1.63
  
• d1gqkb2 appears in SCOPe 2.05
  
• d1gqkb2 appears in SCOPe 2.07
  
• d1gqkb2 appears in the current release, SCOPe 2.08