Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (2 families) contains similar fold but lacks its catalytic centre |
Family d.92.2.2: alpha-D-glucuronidase, N-terminal domain [82737] (1 protein) family GH67 |
Protein alpha-D-glucuronidase, N-terminal domain [82738] (2 species) inverting reaction mechanism |
Species Pseudomonas cellulosa [TaxId:155077] [82739] (5 PDB entries) |
Domain d1gqkb2: 1gqk B:5-151 [76290] Other proteins in same PDB: d1gqka1, d1gqkb1 complexed with bdp, co, edo |
PDB Entry: 1gqk (more details), 1.9 Å
SCOP Domain Sequences for d1gqkb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gqkb2 d.92.2.2 (B:5-151) alpha-D-glucuronidase, N-terminal domain {Pseudomonas cellulosa} edgydmwlryqpiadqtllktyqkqirhlhvagdsptinaaaaelqrglsgllnkpivar deklkdyslvigtpdnspliaslnlgerlqalgaegylleqtrinkrhvvivaansdvgv lygsfhllrliqtqhaleklslssapr
Timeline for d1gqkb2: