Lineage for d1gqkb2 (1gqk B:5-151)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2965096Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) (S)
    contains similar fold but lacks its catalytic centre
  5. 2965146Family d.92.2.2: alpha-D-glucuronidase, N-terminal domain [82737] (1 protein)
    family GH67
    automatically mapped to Pfam PF03648
  6. 2965147Protein alpha-D-glucuronidase, N-terminal domain [82738] (2 species)
    inverting reaction mechanism
  7. 2965156Species Pseudomonas cellulosa [TaxId:155077] [82739] (5 PDB entries)
  8. 2965164Domain d1gqkb2: 1gqk B:5-151 [76290]
    Other proteins in same PDB: d1gqka1, d1gqkb1
    complexed with bdp, co, edo

Details for d1gqkb2

PDB Entry: 1gqk (more details), 1.9 Å

PDB Description: structure of pseudomonas cellulosa alpha-d-glucuronidase complexed with glucuronic acid
PDB Compounds: (B:) alpha-d-glucuronidase

SCOPe Domain Sequences for d1gqkb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gqkb2 d.92.2.2 (B:5-151) alpha-D-glucuronidase, N-terminal domain {Pseudomonas cellulosa [TaxId: 155077]}
edgydmwlryqpiadqtllktyqkqirhlhvagdsptinaaaaelqrglsgllnkpivar
deklkdyslvigtpdnspliaslnlgerlqalgaegylleqtrinkrhvvivaansdvgv
lygsfhllrliqtqhaleklslssapr

SCOPe Domain Coordinates for d1gqkb2:

Click to download the PDB-style file with coordinates for d1gqkb2.
(The format of our PDB-style files is described here.)

Timeline for d1gqkb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gqkb1