Lineage for d1gqka2 (1gqk A:5-151)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 867614Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 868202Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (3 families) (S)
    contains similar fold but lacks its catalytic centre
  5. 868250Family d.92.2.2: alpha-D-glucuronidase, N-terminal domain [82737] (1 protein)
    family GH67
  6. 868251Protein alpha-D-glucuronidase, N-terminal domain [82738] (2 species)
    inverting reaction mechanism
  7. 868260Species Pseudomonas cellulosa [TaxId:155077] [82739] (5 PDB entries)
  8. 868267Domain d1gqka2: 1gqk A:5-151 [76288]
    Other proteins in same PDB: d1gqka1, d1gqkb1

Details for d1gqka2

PDB Entry: 1gqk (more details), 1.9 Å

PDB Description: structure of pseudomonas cellulosa alpha-d-glucuronidase complexed with glucuronic acid
PDB Compounds: (A:) alpha-d-glucuronidase

SCOP Domain Sequences for d1gqka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gqka2 d.92.2.2 (A:5-151) alpha-D-glucuronidase, N-terminal domain {Pseudomonas cellulosa [TaxId: 155077]}
edgydmwlryqpiadqtllktyqkqirhlhvagdsptinaaaaelqrglsgllnkpivar
deklkdyslvigtpdnspliaslnlgerlqalgaegylleqtrinkrhvvivaansdvgv
lygsfhllrliqtqhaleklslssapr

SCOP Domain Coordinates for d1gqka2:

Click to download the PDB-style file with coordinates for d1gqka2.
(The format of our PDB-style files is described here.)

Timeline for d1gqka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gqka1