SCOP 1.71: Domain d1gqjb2: 1gqj B:5-151

Lineage for d1gqjb2 (1gqj B:5-151)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (2 families)
   contains similar fold but lacks its catalytic centre

5. Family d.92.2.2: alpha-D-glucuronidase, N-terminal domain [82737] (1 protein)
   family GH67

6. Protein alpha-D-glucuronidase, N-terminal domain [82738] (2 species)
   inverting reaction mechanism

7. Species Pseudomonas cellulosa [TaxId:155077] [82739] (5 PDB entries)

8. Domain d1gqjb2: 1gqj B:5-151 [76286]
   Other proteins in same PDB: d1gqja1, d1gqjb1
   complexed with co, edo, xyp

Details for d1gqjb2

PDB Entry: 1gqj, 1.9 Å

PDB Description: structure of pseudomonas cellulosa alpha-d-glucuronidase complexed with xylobiose

SCOP Domain Sequences for d1gqjb2:

Sequence; same for both SEQRES and ATOM records:

>d1gqjb2 d.92.2.2 (B:5-151) alpha-D-glucuronidase, N-terminal domain {Pseudomonas cellulosa}
edgydmwlryqpiadqtllktyqkqirhlhvagdsptinaaaaelqrglsgllnkpivar
deklkdyslvigtpdnspliaslnlgerlqalgaegylleqtrinkrhvvivaansdvgv
lygsfhllrliqtqhaleklslssapr

Timeline for d1gqjb2:

• d1gqjb2 first appeared in SCOP 1.63
  
• d1gqjb2 appears in SCOP 1.69
  
• d1gqjb2 appears in SCOP 1.73
  
• d1gqjb2 appears in the current release, SCOPe 2.08