![]() | Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (2 families) ![]() contains similar fold but lacks its catalytic centre |
![]() | Family d.92.2.2: alpha-D-glucuronidase, N-terminal domain [82737] (1 protein) family GH67 |
![]() | Protein alpha-D-glucuronidase, N-terminal domain [82738] (2 species) inverting reaction mechanism |
![]() | Species Pseudomonas cellulosa [TaxId:155077] [82739] (5 PDB entries) |
![]() | Domain d1gqjb2: 1gqj B:5-151 [76286] Other proteins in same PDB: d1gqja1, d1gqjb1 |
PDB Entry: 1gqj (more details), 1.9 Å
SCOP Domain Sequences for d1gqjb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gqjb2 d.92.2.2 (B:5-151) alpha-D-glucuronidase, N-terminal domain {Pseudomonas cellulosa} edgydmwlryqpiadqtllktyqkqirhlhvagdsptinaaaaelqrglsgllnkpivar deklkdyslvigtpdnspliaslnlgerlqalgaegylleqtrinkrhvvivaansdvgv lygsfhllrliqtqhaleklslssapr
Timeline for d1gqjb2: