Lineage for d1gqja2 (1gqj A:5-151)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 607530Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 607984Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (2 families) (S)
    contains similar fold but lacks its catalytic centre
  5. 608014Family d.92.2.2: alpha-D-glucuronidase, N-terminal domain [82737] (1 protein)
    family GH67
  6. 608015Protein alpha-D-glucuronidase, N-terminal domain [82738] (2 species)
    inverting reaction mechanism
  7. 608024Species Pseudomonas cellulosa [TaxId:155077] [82739] (5 PDB entries)
  8. 608033Domain d1gqja2: 1gqj A:5-151 [76284]
    Other proteins in same PDB: d1gqja1, d1gqjb1

Details for d1gqja2

PDB Entry: 1gqj (more details), 1.9 Å

PDB Description: structure of pseudomonas cellulosa alpha-d-glucuronidase complexed with xylobiose

SCOP Domain Sequences for d1gqja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gqja2 d.92.2.2 (A:5-151) alpha-D-glucuronidase, N-terminal domain {Pseudomonas cellulosa}
edgydmwlryqpiadqtllktyqkqirhlhvagdsptinaaaaelqrglsgllnkpivar
deklkdyslvigtpdnspliaslnlgerlqalgaegylleqtrinkrhvvivaansdvgv
lygsfhllrliqtqhaleklslssapr

SCOP Domain Coordinates for d1gqja2:

Click to download the PDB-style file with coordinates for d1gqja2.
(The format of our PDB-style files is described here.)

Timeline for d1gqja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gqja1