Lineage for d1gqia1 (1gqi A:152-712)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 384382Superfamily c.1.8: (Trans)glycosidases [51445] (10 families) (S)
  5. 385375Family c.1.8.10: alpha-D-glucuronidase catalytic domain [82253] (1 protein)
    Glycosyl hydrolase family 67, GH67; structurally related to GH20; contains extra C-terminal alpha-helical subdomain
  6. 385376Protein alpha-D-glucuronidase catalytic domain [82254] (2 species)
    inverting reaction mechanism
  7. 385385Species Pseudomonas cellulosa [TaxId:155077] [82255] (5 PDB entries)
  8. 385386Domain d1gqia1: 1gqi A:152-712 [76279]
    Other proteins in same PDB: d1gqia2, d1gqib2

Details for d1gqia1

PDB Entry: 1gqi (more details), 1.48 Å

PDB Description: structure of pseudomonas cellulosa alpha-d-glucuronidase

SCOP Domain Sequences for d1gqia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gqia1 c.1.8.10 (A:152-712) alpha-D-glucuronidase catalytic domain {Pseudomonas cellulosa}
lqhrvvnhwdnlnrvvergyaglslwdwgslpnylaprytdyarinaslgingtvinnvn
adprvlsdqflqkiaaladafrpygikmylsinfnsprafgdvdtadpldprvqqwwktr
aqkiysyipdfggflvkadsegqpgpqgygrdhaeganmlaaalkpfggvvfwrafvyhp
diedrfrgaydefmpldgkfadnvilqikngpidfqprepfsalfagmsrtnmmmefqit
qeyfgfathlayqgplfeeslktethargegstignilegkvfktrhtgmagvinpgtdr
nwtghpfvqsswyafgrmawdhqisaataadewlrmtfsnqpafiepvkqmmlvsreagv
nyrsplglthlysqgdhygpapwtddlpradwtavyyhrasktgigfnrtktgsnalaqy
pepiakawgdlnsvpedlilwfhhlswdhrmqsgrnlwqelvhkyyqgveqvramqrtwd
qqeayvdaarfaqvkallqvqereavrwrnscvlyfqsvagrpipanyeqpehdleyykm
larttyvpepwhpasssrvlk

SCOP Domain Coordinates for d1gqia1:

Click to download the PDB-style file with coordinates for d1gqia1.
(The format of our PDB-style files is described here.)

Timeline for d1gqia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gqia2