Lineage for d1gqad_ (1gqa D:)
- Root: SCOP 1.63
Class a: All alpha proteins [46456] (171 folds) 
Fold a.24: Four-helical up-and-down bundle [47161] (16 superfamilies)
core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
Superfamily a.24.3: Cytochromes [47175] (2 families) 
Heme-containing proteins
Family a.24.3.2: Cytochrome c' [47179] (1 protein) Protein Cytochrome c' [47180] (8 species) 
Species Rhodobacter sphaeroides [TaxId:1063] [81734] (1 PDB entry) 
Domain d1gqad_: 1gqa D: [76276]
complexed with hec
Details for d1gqad_
PDB Entry: 1gqa (more details), 1.8 Å
PDB Description: cytochrome c' from rhodobacter spheriodes
SCOP Domain Sequences for d1gqad_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gqad_ a.24.3.2 (D:) Cytochrome c' {Rhodobacter sphaeroides}
adaehvvearkgyfslvalefgplaamakgempydaaaakahasdlvtltkydpsdlyap
gtsaddvkgtaakaaiwqdadgfqakgmaffeavaalepaagagqkelaaavgkvggtck
schddfrvkr
SCOP Domain Coordinates for d1gqad_:
Click to download the PDB-style file with coordinates for d1gqad_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gqad_:
- d1gqad_ is new in SCOP 1.63
- d1gqad_ appears in SCOP 1.65
- d1gqad_ appears in the current release, SCOPe 2.08
View in 3D
