Lineage for d1gq5a_ (1gq5 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2379659Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2379660Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2379661Family b.36.1.1: PDZ domain [50157] (47 protein domains)
    Pfam PF00595
  6. 2379779Protein Na+/H+ exchanger regulatory factor, NHERF [63754] (1 species)
  7. 2379780Species Human (Homo sapiens) [TaxId:9606] [63755] (4 PDB entries)
  8. 2379783Domain d1gq5a_: 1gq5 A: [76274]
    first PDZ domain
    complexed with cl

Details for d1gq5a_

PDB Entry: 1gq5 (more details), 2.2 Å

PDB Description: structural determinants of the nherf interaction with beta2-ar and pdgfr
PDB Compounds: (A:) ezrin-radixin-moesin binding phosphoprotein-50

SCOPe Domain Sequences for d1gq5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gq5a_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]}
gmlprlcclekgpngygfhlhgekgklgqyirlvepgspaekagllagdrlvevngenve
kethqqvvsriraalnavrllvvdpeedsfl

SCOPe Domain Coordinates for d1gq5a_:

Click to download the PDB-style file with coordinates for d1gq5a_.
(The format of our PDB-style files is described here.)

Timeline for d1gq5a_: