Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family) |
Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (3 proteins) |
Protein Aspartate carbamoyltransferase catalytic subunit [53673] (4 species) |
Species Escherichia coli [TaxId:562] [53674] (50 PDB entries) Uniprot P00479 |
Domain d1gq3c1: 1gq3 C:2-150 [76272] |
PDB Entry: 1gq3 (more details), 2.01 Å
SCOP Domain Sequences for d1gq3c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gq3c1 c.78.1.1 (C:2-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} nplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfet smhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmahpqegaarlatefsgn vpvlnagdgsnqhptqtlldlftiqetqg
Timeline for d1gq3c1:
View in 3D Domains from other chains: (mouse over for more information) d1gq3a1, d1gq3a2, d1gq3b1, d1gq3b2 |