Lineage for d1gq3b2 (1gq3 B:151-306)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2139045Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2139046Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2139047Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 protein domains)
  6. 2139048Protein Aspartate carbamoyltransferase catalytic subunit [53673] (7 species)
  7. 2139056Species Escherichia coli [TaxId:562] [53674] (63 PDB entries)
    Uniprot P00479
  8. 2139090Domain d1gq3b2: 1gq3 B:151-306 [76271]
    complexed with ca; mutant

Details for d1gq3b2

PDB Entry: 1gq3 (more details), 2.01 Å

PDB Description: structure of the r105a mutant catalytic trimer of escherichia coli aspartate transcarbamoylase at 2.0-a resolution
PDB Compounds: (B:) aspartate carbamoyltransferase

SCOPe Domain Sequences for d1gq3b2:

Sequence, based on SEQRES records: (download)

>d1gq3b2 c.78.1.1 (B:151-306) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
rldnlhvamvgdlkygrtvhsltqalakfdgnrfyfiapdalampqyildmldekgiaws
lhssieevmaevdilymtrvqkerldpseyanvkaqfvlrasdlhnakanmkvlhplprv
deiatdvdktphawyfqqagngifarqallalvlnr

Sequence, based on observed residues (ATOM records): (download)

>d1gq3b2 c.78.1.1 (B:151-306) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
rldnlhvamvgdlkygrtvhsltqalakfdgnrfyfiapdalampqyildmldekgiaws
lhssieevmaevdilymtrvqfvlrasdlhnakanmkvlhplprvdeiatdvdktphawy
fqqagngifarqallalvlnr

SCOPe Domain Coordinates for d1gq3b2:

Click to download the PDB-style file with coordinates for d1gq3b2.
(The format of our PDB-style files is described here.)

Timeline for d1gq3b2: