SCOPe 2.08: Domain d1gq1b1: 1gq1 B:9-133

Lineage for d1gq1b1 (1gq1 B:9-133)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.2: N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46671] (1 protein)

6. Protein N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46672] (4 species)
   the C-terminal domain is a 8-bladed beta-propeller

7. Species Paracoccus pantotrophus [TaxId:82367] [46673] (11 PDB entries)
   formerly Thiosphaera pantotropha

8. Domain d1gq1b1: 1gq1 B:9-133 [76266]
   Other proteins in same PDB: d1gq1a2, d1gq1b2
   complexed with dhe, gol, hec, so4; mutant

Details for d1gq1b1

PDB Entry: 1gq1, 1.4 Å

PDB Description: cytochrome cd1 nitrite reductase, y25s mutant, oxidised form

PDB Compounds: (B:) cytochrome cd1 nitrite reductase

SCOPe Domain Sequences for d1gq1b1:

Sequence; same for both SEQRES and ATOM records:

>d1gq1b1 a.3.1.2 (B:9-133) N-terminal (heme c) domain of cytochrome cd1-nitrite reductase {Paracoccus pantotrophus [TaxId: 82367]}
dpaaaledhktrtdnrsepsldnlaqqdvaapgapegvsalsdaqyneankiyfercagc
hgvlrkgatgkaltpdltrdlgfdylqsfitygspagmpnwgtsgelsaeqvdlmanyll
ldpaa

Timeline for d1gq1b1:

• d1gq1b1 first appeared in SCOP 1.63
  
• d1gq1b1 appears in SCOPe 2.07