![]() | Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
![]() | Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
![]() | Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) ![]() |
![]() | Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins) |
![]() | Protein Chitinase B [54560] (1 species) |
![]() | Species Serratia marcescens [TaxId:615] [54561] (10 PDB entries) |
![]() | Domain d1gpfb3: 1gpf B:292-379 [76259] Other proteins in same PDB: d1gpfa1, d1gpfa2, d1gpfb1, d1gpfb2 complexed with so4 |
PDB Entry: 1gpf (more details), 1.85 Å
SCOP Domain Sequences for d1gpfb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gpfb3 d.26.3.1 (B:292-379) Chitinase B {Serratia marcescens} ygrafkgvsggnggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqg nygyqrlwndktktpylyhaqnglfvty
Timeline for d1gpfb3: