Lineage for d1gpfb2 (1gpf B:3-291,B:380-446)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1339265Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1340705Family c.1.8.5: Type II chitinase [51534] (15 proteins)
    glycosylase family 18
  6. 1340764Protein Chitinase B, catalytic domain [51546] (1 species)
  7. 1340765Species Serratia marcescens [TaxId:615] [51547] (18 PDB entries)
  8. 1340783Domain d1gpfb2: 1gpf B:3-291,B:380-446 [76258]
    Other proteins in same PDB: d1gpfa1, d1gpfa3, d1gpfb1, d1gpfb3
    complexed with so4

Details for d1gpfb2

PDB Entry: 1gpf (more details), 1.85 Å

PDB Description: chitinase b from serratia marcescens in complex with inhibitor psammaplin
PDB Compounds: (B:) chitinase b

SCOPe Domain Sequences for d1gpfb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gpfb2 c.1.8.5 (B:3-291,B:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]}
trkavigyyfiptnqinnytetdtsvvpfpvsnitpakakqlthinfsfldinsnlecaw
dpatndakardvvnrltalkahnpslrimfsiggwyysndlgvshanyvnavktpasrak
faqscvrimkdygfdgvdidweypqaaevdgfiaalqeirtllnqqtitdgrqalpyqlt
iagaggafflsryysklaqivapldyinlmtydlagpwekvtnhqaalfgdaagptfyna
lreanlgwsweeltrafpspfsltvdaavqqhlmmegvpsakivmgvpfXddaesfkyka
kyikqqqlggvmfwhlgqdnrngdllaaldryfnaadyddsqldmgtglrytgvgpg

SCOPe Domain Coordinates for d1gpfb2:

Click to download the PDB-style file with coordinates for d1gpfb2.
(The format of our PDB-style files is described here.)

Timeline for d1gpfb2: