SCOP 1.69: Domain d1gp7c_: 1gp7 C:

Lineage for d1gp7c_ (1gp7 C:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)

6. Protein Snake phospholipase A2 [48624] (35 species)

7. Species King cobra (Ophiophagus hannah) [TaxId:8665] [81939] (1 PDB entry)

8. Domain d1gp7c_: 1gp7 C: [76253]

Details for d1gp7c_

PDB Entry: 1gp7, 2.6 Å

PDB Description: acidic phospholipase a2 from venom of ophiophagus hannah

SCOP Domain Sequences for d1gp7c_:

Sequence; same for both SEQRES and ATOM records:

>d1gp7c_ a.133.1.2 (C:) Snake phospholipase A2 {King cobra (Ophiophagus hannah)}
hliqfgnmiqctvpgflswikyadygcycgaggsgtpvdkldrccqvhdncytqaqklpa
cssimdspyvkiysydcsertvtckadndecaaficncdrvaahcfaaspynnnnynidt
ttrc

Timeline for d1gp7c_:

• d1gp7c_ first appeared in SCOP 1.63
  
• d1gp7c_ appears in SCOP 1.67
  
• d1gp7c_ appears in SCOP 1.71
  
• d1gp7c_ appears in the current release, SCOPe 2.08