SCOPe 2.07: Domain d1gp7b_: 1gp7 B:

Lineage for d1gp7b_ (1gp7 B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein Snake phospholipase A2 [48624] (38 species)

7. Species King cobra (Ophiophagus hannah) [TaxId:8665] [81939] (1 PDB entry)

8. Domain d1gp7b_: 1gp7 B: [76252]
   complexed with ca

Details for d1gp7b_

PDB Entry: 1gp7, 2.6 Å

PDB Description: acidic phospholipase a2 from venom of ophiophagus hannah

PDB Compounds: (B:) phospholipase a2

SCOPe Domain Sequences for d1gp7b_:

Sequence; same for both SEQRES and ATOM records:

>d1gp7b_ a.133.1.2 (B:) Snake phospholipase A2 {King cobra (Ophiophagus hannah) [TaxId: 8665]}
hliqfgnmiqctvpgflswikyadygcycgaggsgtpvdkldrccqvhdncytqaqklpa
cssimdspyvkiysydcsertvtckadndecaaficncdrvaahcfaaspynnnnynidt
ttrc

Timeline for d1gp7b_:

• d1gp7b_ first appeared in SCOP 1.63
  
• d1gp7b_ appears in SCOPe 2.06
  
• d1gp7b_ appears in the current release, SCOPe 2.08