Lineage for d1gp7b_ (1gp7 B:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 217995Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulphide-linked, and a calcium-binding loop
  4. 217996Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 218001Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)
  6. 218072Protein Snake phospholipase A2 [48624] (19 species)
  7. 218125Species King cobra (Ophiophagus hannah) [TaxId:8665] [81939] (1 PDB entry)
  8. 218127Domain d1gp7b_: 1gp7 B: [76252]

Details for d1gp7b_

PDB Entry: 1gp7 (more details), 2.6 Å

PDB Description: acidic phospholipase a2 from venom of ophiophagus hannah

SCOP Domain Sequences for d1gp7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gp7b_ a.133.1.2 (B:) Snake phospholipase A2 {King cobra (Ophiophagus hannah)}
hliqfgnmiqctvpgflswikyadygcycgaggsgtpvdkldrccqvhdncytqaqklpa
cssimdspyvkiysydcsertvtckadndecaaficncdrvaahcfaaspynnnnynidt
ttrc

SCOP Domain Coordinates for d1gp7b_:

Click to download the PDB-style file with coordinates for d1gp7b_.
(The format of our PDB-style files is described here.)

Timeline for d1gp7b_: