Lineage for d1gp7b_ (1gp7 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2732921Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2733039Protein Snake phospholipase A2 [48624] (38 species)
  7. 2733171Species King cobra (Ophiophagus hannah) [TaxId:8665] [81939] (1 PDB entry)
  8. 2733173Domain d1gp7b_: 1gp7 B: [76252]
    complexed with ca

Details for d1gp7b_

PDB Entry: 1gp7 (more details), 2.6 Å

PDB Description: acidic phospholipase a2 from venom of ophiophagus hannah
PDB Compounds: (B:) phospholipase a2

SCOPe Domain Sequences for d1gp7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gp7b_ a.133.1.2 (B:) Snake phospholipase A2 {King cobra (Ophiophagus hannah) [TaxId: 8665]}
hliqfgnmiqctvpgflswikyadygcycgaggsgtpvdkldrccqvhdncytqaqklpa
cssimdspyvkiysydcsertvtckadndecaaficncdrvaahcfaaspynnnnynidt
ttrc

SCOPe Domain Coordinates for d1gp7b_:

Click to download the PDB-style file with coordinates for d1gp7b_.
(The format of our PDB-style files is described here.)

Timeline for d1gp7b_: