Lineage for d1gp7a_ (1gp7 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2015621Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2015622Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2015627Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2015739Protein Snake phospholipase A2 [48624] (38 species)
  7. 2015867Species King cobra (Ophiophagus hannah) [TaxId:8665] [81939] (1 PDB entry)
  8. 2015868Domain d1gp7a_: 1gp7 A: [76251]
    complexed with ca

Details for d1gp7a_

PDB Entry: 1gp7 (more details), 2.6 Å

PDB Description: acidic phospholipase a2 from venom of ophiophagus hannah
PDB Compounds: (A:) phospholipase a2

SCOPe Domain Sequences for d1gp7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gp7a_ a.133.1.2 (A:) Snake phospholipase A2 {King cobra (Ophiophagus hannah) [TaxId: 8665]}
hliqfgnmiqctvpgflswikyadygcycgaggsgtpvdkldrccqvhdncytqaqklpa
cssimdspyvkiysydcsertvtckadndecaaficncdrvaahcfaaspynnnnynidt
ttrc

SCOPe Domain Coordinates for d1gp7a_:

Click to download the PDB-style file with coordinates for d1gp7a_.
(The format of our PDB-style files is described here.)

Timeline for d1gp7a_: