Lineage for d1go2a1 (1go2 A:9-141)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 669479Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 669704Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) (S)
  5. 669726Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (9 proteins)
    coupled with a NADP-binding domain of alpha/beta class
  6. 669746Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (8 species)
  7. 669749Species Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId:1167] [50420] (24 PDB entries)
  8. 669756Domain d1go2a1: 1go2 A:9-141 [76243]
    Other proteins in same PDB: d1go2a2
    complexed with fad, so4; mutant

Details for d1go2a1

PDB Entry: 1go2 (more details), 1.7 Å

PDB Description: structure of ferredoxin-nadp+ reductase with lys 72 replaced by glu (k72e)
PDB Compounds: (A:) ferredoxin--nadp+ reductase

SCOP Domain Sequences for d1go2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1go2a1 b.43.4.2 (A:9-141) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId: 1167]}
dvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsigiippgvd
kngepeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcstylthiepgs
evkitgpvgkeml

SCOP Domain Coordinates for d1go2a1:

Click to download the PDB-style file with coordinates for d1go2a1.
(The format of our PDB-style files is described here.)

Timeline for d1go2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1go2a2