Lineage for d1gnxb_ (1gnx B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2082913Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 protein domains)
  6. 2082923Protein Beta-glucosidase A [51528] (9 species)
  7. 2082963Species Streptomyces sp. [TaxId:1931] [82248] (2 PDB entries)
  8. 2082965Domain d1gnxb_: 1gnx B: [76242]
    complexed with so4, suc

Details for d1gnxb_

PDB Entry: 1gnx (more details), 1.68 Å

PDB Description: b-glucosidase from streptomyces sp
PDB Compounds: (B:) Beta-glucosidase

SCOPe Domain Sequences for d1gnxb_:

Sequence, based on SEQRES records: (download)

>d1gnxb_ c.1.8.4 (B:) Beta-glucosidase A {Streptomyces sp. [TaxId: 1931]}
altfpegflwgsatasyqiegaaaedgrtpsiwdtyartpgrvrngdtgdvatdhyhrwr
edvalmaelglgayrfslawpriqptgrgpalqkgldfyrrladellakgiqpvatlyhw
dlpqelenaggwperataerfaeyaaiaadalgdrvktwttlnepwcsaflgygsgvhap
grtdpvaalraahhlnlghglavqalrdrlpadaqcsvtlnihhvrpltdsdadadavrr
idalanrvftgpmlqgaypedlvkdtagltdwsfvrdgdlrlahqkldflgvnyysptlv
seadgsgthnsdghgrsahspwpgadrvafhqppgettamgwavdpsglyellrrlssdf
palplvitengaafhdyadpegnvndperiayvrdhlaavhraikdgsdvrgyflwslld
nfewahgyskrfgavyvdyptgtripkasarwyaevartgvlpta

Sequence, based on observed residues (ATOM records): (download)

>d1gnxb_ c.1.8.4 (B:) Beta-glucosidase A {Streptomyces sp. [TaxId: 1931]}
altfpegflwgsatasyqiegaaaedgrtpsiwdtyartpgrvrngdtgdvatdhyhrwr
edvalmaelglgayrfslawpriqptgrgpalqkgldfyrrladellakgiqpvatlyhw
dlpqelenaggwperataerfaeyaaiaadalgdrvktwttlnepwcsaflgygsgvhap
grtdpvaalraahhlnlghglavqalrdrlpadaqcsvtlnihhvrpltdsdadadavrr
idalanrvftgpmlqgaypedlvkdtagltdwsfvrdgdlrlahqkldflgvnyysptlv
shspwpgadrvafhqppgettamgwavdpsglyellrrlssdfpalplvitengaafhdy
adpegnvndperiayvrdhlaavhraikdgsdvrgyflwslldnfewahgyskrfgavyv
dyptgtripkasarwyaevartgvlpta

SCOPe Domain Coordinates for d1gnxb_:

Click to download the PDB-style file with coordinates for d1gnxb_.
(The format of our PDB-style files is described here.)

Timeline for d1gnxb_: