Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Glycogen synthase kinase-3 beta (Gsk3b) [69823] (1 species) CMGC group; GSK3 subfamily; serine/threonine kinase |
Species Human (Homo sapiens) [TaxId:9606] [69824] (43 PDB entries) Uniprot P49841 35-383 ! Uniprot P49841 35-384 |
Domain d1gnga_: 1gng A: [76239] complexed with so4, trs |
PDB Entry: 1gng (more details), 2.6 Å
SCOPe Domain Sequences for d1gnga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gnga_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} kvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfkn relqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhysrakqtlpv iyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvs yicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgt ptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarltpleac ahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphariq
Timeline for d1gnga_: