Lineage for d1gmgb_ (1gmg B:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 767812Fold a.30: ROP-like [47379] (8 superfamilies)
    4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist
  4. 767813Superfamily a.30.1: ROP protein [47380] (1 family) (S)
  5. 767814Family a.30.1.1: ROP protein [47381] (1 protein)
  6. 767815Protein ROP protein [47382] (1 species)
  7. 767816Species Escherichia coli [TaxId:562] [47383] (12 PDB entries)
    Uniprot P03051
  8. 767833Domain d1gmgb_: 1gmg B: [76235]
    single-residue mutant with a changed dimer topology

Details for d1gmgb_

PDB Entry: 1gmg (more details), 1.9 Å

PDB Description: alanine 31 proline mutant of rop protein, monoclinic form
PDB Compounds: (B:) Regulatory protein rop

SCOP Domain Sequences for d1gmgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gmgb_ a.30.1.1 (B:) ROP protein {Escherichia coli [TaxId: 562]}
kqektalnmarfirsqtltlleklneldpdeqadiceslhdhadelyrsclarf

SCOP Domain Coordinates for d1gmgb_:

Click to download the PDB-style file with coordinates for d1gmgb_.
(The format of our PDB-style files is described here.)

Timeline for d1gmgb_:

767833
d1gmgb_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1gmga_