Lineage for d1gm4a_ (1gm4 A:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 218289Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 218290Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 218291Family a.138.1.1: Cytochrome c3-like [48696] (4 proteins)
  6. 218299Protein Cytochrome c3 [48697] (6 species)
    contains four heme groups
  7. 218305Species Desulfovibrio desulfuricans, different strains [TaxId:876] [48698] (6 PDB entries)
  8. 218310Domain d1gm4a_: 1gm4 A: [76232]
    complexed with hec, so4

Details for d1gm4a_

PDB Entry: 1gm4 (more details), 2.05 Å

PDB Description: oxidised structure of cytochrome c3 from desulfovibrio desulfuricans atcc 27774 at ph 7.6

SCOP Domain Sequences for d1gm4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gm4a_ a.138.1.1 (A:) Cytochrome c3 {Desulfovibrio desulfuricans, different strains}
apavpdkpvevkgsqktvmfphaphekvecvtchhlvdgkesyakcgssgchddltakkg
ekslyyvvhargelkhtsclachskvvaekpelkkdltgcakskchp

SCOP Domain Coordinates for d1gm4a_:

Click to download the PDB-style file with coordinates for d1gm4a_.
(The format of our PDB-style files is described here.)

Timeline for d1gm4a_: