Class a: All alpha proteins [46456] (171 folds) |
Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold |
Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) duplication: contains multiple CxxCH motifs |
Family a.138.1.1: Cytochrome c3-like [48696] (4 proteins) |
Protein Cytochrome c3 [48697] (6 species) contains four heme groups |
Species Desulfovibrio desulfuricans, different strains [TaxId:876] [48698] (6 PDB entries) |
Domain d1gm4a_: 1gm4 A: [76232] complexed with hec, so4 |
PDB Entry: 1gm4 (more details), 2.05 Å
SCOP Domain Sequences for d1gm4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gm4a_ a.138.1.1 (A:) Cytochrome c3 {Desulfovibrio desulfuricans, different strains} apavpdkpvevkgsqktvmfphaphekvecvtchhlvdgkesyakcgssgchddltakkg ekslyyvvhargelkhtsclachskvvaekpelkkdltgcakskchp
Timeline for d1gm4a_: