SCOP 1.65: Domain d1gheb_: 1ghe B:

Lineage for d1gheb_ (1ghe B:)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (4 families)

5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (14 proteins)

6. Protein Tabtoxin resistance protein [82747] (1 species)
   possesses HAT activity

7. Species Pseudomonas syringae [TaxId:317] [82748] (2 PDB entries)

8. Domain d1gheb_: 1ghe B: [76223]
   complexed with aco, mse

Details for d1gheb_

PDB Entry: 1ghe, 1.55 Å

PDB Description: crystal structure of tabtoxin resistance protein complexed with an acyl coenzyme a

SCOP Domain Sequences for d1gheb_:

Sequence; same for both SEQRES and ATOM records:

>d1gheb_ d.108.1.1 (B:) Tabtoxin resistance protein {Pseudomonas syringae}
haqlrrvtaesfahyrhglaqllfetvhggasvgfmadldmqqayawcdglkadiaagsl
llwvvaeddnvlasaqlslcqkpnglnraevqklmvlpsargrglgrqlmdeveqvavkh
krgllhldteagsvaeafysalaytrvgelpgycatpdgrlhptaiyfktl

Timeline for d1gheb_:

• d1gheb_ first appeared in SCOP 1.63
  
• d1gheb_ appears in SCOP 1.67
  
• d1gheb_ appears in the current release, SCOPe 2.08