Lineage for d1g9ea_ (1g9e A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 781558Protein Camelid IG heavy chain variable domain, VHh [88563] (3 species)
  7. 781600Species Llama (Lama glama) [TaxId:9844] [88565] (8 PDB entries)
  8. 781609Domain d1g9ea_: 1g9e A: [76216]
    anti-gonadotropin alpha subunit VHh domain

Details for d1g9ea_

PDB Entry: 1g9e (more details)

PDB Description: solution structure and relaxation measurements of an antigen-free heavy chain variable domain (vhh) from llama
PDB Compounds: (A:) h14

SCOP Domain Sequences for d1g9ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g9ea_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]}
qvqlqesggglvqaggslrlscaasgrtgstydmgwfrqapgkeresvaainwdsartyy
assvrgrftisrdnakktvylqmnslkpedtavytcgageggtwdswgqgtqvtvss

SCOP Domain Coordinates for d1g9ea_:

Click to download the PDB-style file with coordinates for d1g9ea_.
(The format of our PDB-style files is described here.)

Timeline for d1g9ea_: