Lineage for d1g9ea_ (1g9e A:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287101Protein Camelid IG heavy chain variable domain, VHh [88563] (2 species)
  7. 287128Species Llama (Lama glama) [TaxId:9844] [88565] (6 PDB entries)
  8. 287135Domain d1g9ea_: 1g9e A: [76216]
    anti-gonadotropin alpha subunit VHh domain

Details for d1g9ea_

PDB Entry: 1g9e (more details)

PDB Description: solution structure and relaxation measurements of an antigen-free heavy chain variable domain (vhh) from llama

SCOP Domain Sequences for d1g9ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g9ea_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama)}
qvqlqesggglvqaggslrlscaasgrtgstydmgwfrqapgkeresvaainwdsartyy
assvrgrftisrdnakktvylqmnslkpedtavytcgageggtwdswgqgtqvtvss

SCOP Domain Coordinates for d1g9ea_:

Click to download the PDB-style file with coordinates for d1g9ea_.
(The format of our PDB-style files is described here.)

Timeline for d1g9ea_: