Lineage for d1g9ea_ (1g9e A:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 220129Species Llama (Lama glama), anti-gonadotropin alpha subunit VH domain [48917] (2 PDB entries)
  8. 220131Domain d1g9ea_: 1g9e A: [76216]

Details for d1g9ea_

PDB Entry: 1g9e (more details)

PDB Description: solution structure and relaxation measurements of an antigen-free heavy chain variable domain (vhh) from llama

SCOP Domain Sequences for d1g9ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g9ea_ b.1.1.1 (A:) Immunoglobulin (variable domains of L and H chains) {Llama (Lama glama), anti-gonadotropin alpha subunit VH domain}
qvqlqesggglvqaggslrlscaasgrtgstydmgwfrqapgkeresvaainwdsartyy
assvrgrftisrdnakktvylqmnslkpedtavytcgageggtwdswgqgtqvtvss

SCOP Domain Coordinates for d1g9ea_:

Click to download the PDB-style file with coordinates for d1g9ea_.
(The format of our PDB-style files is described here.)

Timeline for d1g9ea_: