![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
![]() | Species Llama (Lama glama), anti-gonadotropin alpha subunit VH domain [48917] (2 PDB entries) |
![]() | Domain d1g9ea_: 1g9e A: [76216] |
PDB Entry: 1g9e (more details)
SCOP Domain Sequences for d1g9ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g9ea_ b.1.1.1 (A:) Immunoglobulin (variable domains of L and H chains) {Llama (Lama glama), anti-gonadotropin alpha subunit VH domain} qvqlqesggglvqaggslrlscaasgrtgstydmgwfrqapgkeresvaainwdsartyy assvrgrftisrdnakktvylqmnslkpedtavytcgageggtwdswgqgtqvtvss
Timeline for d1g9ea_: