Lineage for d1g9ca3 (1g9c A:1-533)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 415443Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 415444Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) (S)
  5. 415575Family d.92.1.7: Clostridium neurotoxins, catalytic domain [55512] (1 protein)
  6. 415576Protein Botulinum neurotoxin [55513] (2 species)
  7. 415581Species Clostridium botulinum, serotype B [TaxId:1491] [55515] (15 PDB entries)
  8. 415590Domain d1g9ca3: 1g9c A:1-533 [76210]
    Other proteins in same PDB: d1g9ca1, d1g9ca2, d1g9ca4
    complexed with bab, zn

Details for d1g9ca3

PDB Entry: 1g9c (more details), 2.35 Å

PDB Description: crystal structure of clostridium botulinum neurotoxin b complexed with an inhibitor (experiment 4)

SCOP Domain Sequences for d1g9ca3:

Sequence, based on SEQRES records: (download)

>d1g9ca3 d.92.1.7 (A:1-533) Botulinum neurotoxin {Clostridium botulinum, serotype B}
pvtinnfnyndpidnnniimmeppfargtgryykafkitdriwiiperytfgykpedfnk
ssgifnrdvceyydpdylntndkkniflqtmiklfnrikskplgekllemiingipylgd
rrvpleefntniasvtvnklisnpgeverkkgifanliifgpgpvlnenetidigiqnhf
asregfggimqmkfcpeyvsvfnnvqenkgasifnrrgyfsdpalilmhelihvlhglyg
ikvddlpivpnekkffmqstdaiqaeelytfggqdpsiitpstdksiydkvlqnfrgivd
rlnkvlvcisdpnininiyknkfkdkykfvedsegkysidvesfdklykslmfgftetni
aenykiktrasyfsdslppvkiknlldneiytieegfnisdkdmekeyrgqnkainkqay
eeiskehlavykiqmcksvkapgicidvdnedlffiadknsfsddlsknerieyntqsny
iendfpinelildtdliskielpsentesltdfnvdvpvyekqpaikkiftde

Sequence, based on observed residues (ATOM records): (download)

>d1g9ca3 d.92.1.7 (A:1-533) Botulinum neurotoxin {Clostridium botulinum, serotype B}
pvtinnfnyndpidnnniimmeppfargtgryykafkitdriwiiperytfgykpedfnk
ssgifnrdvceyydpdylntndkkniflqtmiklfnrikskplgekllemiingipylgd
rrvpleefntniasvtvnklisnpgeverkkgifanliifgpgpvlnenetidigiqnhf
asregfggimqmkfcpeyvsvfnnvqenkgasifnrrgyfsdpalilmhelihvlhglyg
ikvddlpivpnekkffmqstdaiqaeelytfggqdpsiitpstdksiydkvlqnfrgivd
rlnkvlvcisdpnininiyknkfkdkykfvedsegkysidvesfdklykslmfgftetni
aenykiktrasyfsdslppvkiknlldneiytieegfnisdkdmekeyrgqnkainkqay
eeiskehlavykiqmcksvgicidvdnedlffiadknsfsddlsknerieyntqsnyien
dfpinelildtdliskielpsentesltdfnvdvpvyekqpaikkiftde

SCOP Domain Coordinates for d1g9ca3:

Click to download the PDB-style file with coordinates for d1g9ca3.
(The format of our PDB-style files is described here.)

Timeline for d1g9ca3: