Lineage for d1g9ca2 (1g9c A:1080-1290)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 229692Fold b.42: beta-Trefoil [50352] (6 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 229893Superfamily b.42.4: STI-like [50386] (2 families) (S)
  5. 229922Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (2 proteins)
    overall fold is very similar to that of the STI family
  6. 229923Protein Botulinum neurotoxin [50402] (2 species)
  7. 229926Species Clostridium botulinum, serotype B [TaxId:1491] [50404] (7 PDB entries)
  8. 229930Domain d1g9ca2: 1g9c A:1080-1290 [76209]
    Other proteins in same PDB: d1g9ca1, d1g9ca3, d1g9ca4
    complexed with bab, zn

Details for d1g9ca2

PDB Entry: 1g9c (more details), 2.35 Å

PDB Description: crystal structure of clostridium botulinum neurotoxin b complexed with an inhibitor (experiment 4)

SCOP Domain Sequences for d1g9ca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g9ca2 b.42.4.2 (A:1080-1290) Botulinum neurotoxin {Clostridium botulinum, serotype B}
seylkdfwgnplmynkeyymfnagnknsyiklkkdspvgeiltrskynqnskyinyrdly
igekfiirrksnsqsinddivrkedyiyldffnlnqewrvytykyfkkeeeklflapisd
sdefyntiqikeydeqptyscqllfkkdeestdeigligihrfyesgivfeeykdyfcis
kwylkevkrkpynlklgcnwqfipkdegwte

SCOP Domain Coordinates for d1g9ca2:

Click to download the PDB-style file with coordinates for d1g9ca2.
(The format of our PDB-style files is described here.)

Timeline for d1g9ca2: