Lineage for d1g9ba4 (1g9b A:534-861)

  1. Root: SCOP 1.63
  2. 271841Class h: Coiled coil proteins [57942] (6 folds)
  3. 272641Fold h.4: Antiparallel coiled-coil [58086] (13 superfamilies)
    this is not a true fold; contains at least two very long antiparallel helices
  4. 272650Superfamily h.4.2: Clostridium neurotoxins, "coiled-coil" domain [58091] (1 family) (S)
  5. 272651Family h.4.2.1: Clostridium neurotoxins, "coiled-coil" domain [58092] (1 protein)
  6. 272652Protein Botulinum neurotoxin [58093] (2 species)
  7. 272655Species Clostridium botulinum, serotype B [TaxId:1491] [58095] (7 PDB entries)
  8. 272657Domain d1g9ba4: 1g9b A:534-861 [76207]
    Other proteins in same PDB: d1g9ba1, d1g9ba2, d1g9ba3
    complexed with bab, zn

Details for d1g9ba4

PDB Entry: 1g9b (more details), 2 Å

PDB Description: crystal structure of clostridium botulinum neurotoxin b complexed with an inhibitor (experiment 1)

SCOP Domain Sequences for d1g9ba4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g9ba4 h.4.2.1 (A:534-861) Botulinum neurotoxin {Clostridium botulinum, serotype B}
ntifqylysqtfpldirdisltssfddallfsnkvysffsmdyiktankvveaglfagwv
kqivndfvieanksntmdkiadislivpyiglalnvgnetakgnfenafeiagasillef
ipellipvvgafllesyidnknkiiktidnaltkrnekwsdmyglivaqwlstvntqfyt
ikegmykalnyqaqaleeiikyryniysekeksninidfndinsklneginqaidninnf
ingcsvsylmkkmiplaveklldfdntlkknllnyidenklyligsaeyekskvnkylkt
impfdlsiytndtiliemfnkynseiln

SCOP Domain Coordinates for d1g9ba4:

Click to download the PDB-style file with coordinates for d1g9ba4.
(The format of our PDB-style files is described here.)

Timeline for d1g9ba4: