Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.9: DsbC/DsbG C-terminal domain-like [52898] (3 proteins) elaborated common fold |
Protein Disulfide bond isomerase, DsbC, C-terminal domain [52899] (2 species) |
Species Escherichia coli [TaxId:562] [52900] (5 PDB entries) Uniprot P21892 |
Domain d1g0ta1: 1g0t A:61-215 [76196] Other proteins in same PDB: d1g0ta2, d1g0tb2 complexed with peg; mutant |
PDB Entry: 1g0t (more details), 2.6 Å
SCOPe Domain Sequences for d1g0ta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g0ta1 c.47.1.9 (A:61-215) Disulfide bond isomerase, DsbC, C-terminal domain {Escherichia coli [TaxId: 562]} nvtnkmllkqlnalekemivykapqekhvitvftditcgyshklheqmadynalgitvry lafprqgldsdaekemkaiwcakdknkafddvmagksvapascdvdiadhyalgvqlgvs gtpavvlsngtlvpgyqppkemkefldehqkmtsg
Timeline for d1g0ta1: