Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (12 families) |
Family c.47.1.9: Disulfide bond isomerase, DsbC, C-terminal domain [52898] (1 protein) elaborated common fold |
Protein Disulfide bond isomerase, DsbC, C-terminal domain [52899] (1 species) |
Species Escherichia coli [TaxId:562] [52900] (2 PDB entries) |
Domain d1g0ta1: 1g0t A:61-215 [76196] Other proteins in same PDB: d1g0ta2, d1g0tb2 |
PDB Entry: 1g0t (more details), 2.6 Å
SCOP Domain Sequences for d1g0ta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g0ta1 c.47.1.9 (A:61-215) Disulfide bond isomerase, DsbC, C-terminal domain {Escherichia coli} nvtnkmllkqlnalekemivykapqekhvitvftditcgyshklheqmadynalgitvry lafprqgldsdaekemkaiwcakdknkafddvmagksvapascdvdiadhyalgvqlgvs gtpavvlsngtlvpgyqppkemkefldehqkmtsg
Timeline for d1g0ta1: