Lineage for d1g0ta1 (1g0t A:61-215)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877401Family c.47.1.9: DsbC/DsbG C-terminal domain-like [52898] (3 proteins)
    elaborated common fold
  6. 2877402Protein Disulfide bond isomerase, DsbC, C-terminal domain [52899] (2 species)
  7. 2877403Species Escherichia coli [TaxId:562] [52900] (5 PDB entries)
    Uniprot P21892
  8. 2877410Domain d1g0ta1: 1g0t A:61-215 [76196]
    Other proteins in same PDB: d1g0ta2, d1g0tb2
    complexed with peg; mutant

Details for d1g0ta1

PDB Entry: 1g0t (more details), 2.6 Å

PDB Description: dsbc mutant c101s
PDB Compounds: (A:) thiol:disulfide interchange protein dsbc

SCOPe Domain Sequences for d1g0ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g0ta1 c.47.1.9 (A:61-215) Disulfide bond isomerase, DsbC, C-terminal domain {Escherichia coli [TaxId: 562]}
nvtnkmllkqlnalekemivykapqekhvitvftditcgyshklheqmadynalgitvry
lafprqgldsdaekemkaiwcakdknkafddvmagksvapascdvdiadhyalgvqlgvs
gtpavvlsngtlvpgyqppkemkefldehqkmtsg

SCOPe Domain Coordinates for d1g0ta1:

Click to download the PDB-style file with coordinates for d1g0ta1.
(The format of our PDB-style files is described here.)

Timeline for d1g0ta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1g0ta2