SCOP 1.63: Domain d1ftxb2: 1ftx B:12-244

Lineage for d1ftxb2 (1ftx B:12-244)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.6: PLP-binding barrel [51419] (2 families)
   circular permutation of the canonical fold: begins with an alpha helix and ends with a beta-strand

5. Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (2 proteins)

6. Protein Alanine racemase [51421] (1 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [51422] (7 PDB entries)

8. Domain d1ftxb2: 1ftx B:12-244 [76194]
   Other proteins in same PDB: d1ftxa1, d1ftxb1
   complexed with in5, kcx

Details for d1ftxb2

PDB Entry: 1ftx, 2.2 Å

PDB Description: crystal structure of alanine racemase in complex with d-alanine phosphonate

SCOP Domain Sequences for d1ftxb2:

Sequence; same for both SEQRES and ATOM records:

>d1ftxb2 c.1.6.1 (B:12-244) Alanine racemase {Bacillus stearothermophilus}
vdldaiydnvenlrrllpddthimavvkanayghgdvqvartaleagasrlavafldeal
alrekgieapilvlgasrpadaalaaqqrialtvfrsdwleeasalysgpfpihfhlkmd
tgmgrlgvkdeeetkrivalierhphfvleglythfatadevntdyfsyqytrflhmlew
lpsrpplvhcansaaslrfpdrtfnmvrfgiamyglapspgikpllpyplkea

Timeline for d1ftxb2:

• d1ftxb2 is new in SCOP 1.63
  
• d1ftxb2 appears in SCOP 1.65
  
• d1ftxb2 appears in the current release, SCOPe 2.08