Lineage for d1ftxb2 (1ftx B:12-244)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829052Superfamily c.1.6: PLP-binding barrel [51419] (2 families) (S)
    circular permutation of the canonical fold: begins with an alpha helix and ends with a beta-strand
  5. 2829053Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (4 proteins)
  6. 2829054Protein Alanine racemase [51421] (3 species)
  7. 2829055Species Bacillus stearothermophilus [TaxId:1422] [51422] (8 PDB entries)
  8. 2829071Domain d1ftxb2: 1ftx B:12-244 [76194]
    Other proteins in same PDB: d1ftxa1, d1ftxb1
    complexed with epc

Details for d1ftxb2

PDB Entry: 1ftx (more details), 2.2 Å

PDB Description: crystal structure of alanine racemase in complex with d-alanine phosphonate
PDB Compounds: (B:) alanine racemase

SCOPe Domain Sequences for d1ftxb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ftxb2 c.1.6.1 (B:12-244) Alanine racemase {Bacillus stearothermophilus [TaxId: 1422]}
vdldaiydnvenlrrllpddthimavvkanayghgdvqvartaleagasrlavafldeal
alrekgieapilvlgasrpadaalaaqqrialtvfrsdwleeasalysgpfpihfhlkmd
tgmgrlgvkdeeetkrivalierhphfvleglythfatadevntdyfsyqytrflhmlew
lpsrpplvhcansaaslrfpdrtfnmvrfgiamyglapspgikpllpyplkea

SCOPe Domain Coordinates for d1ftxb2:

Click to download the PDB-style file with coordinates for d1ftxb2.
(The format of our PDB-style files is described here.)

Timeline for d1ftxb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ftxb1